Nabídka
Dotazník
K čemu se přikláníte?
  • Evoluce (415)
  • Kreace (mladá Země) (195)
  • Kreace (stará Země) (56)
  • Teistická evoluce (71)
  • K žádné z možností (40)
Hledat
Hledaný řetězec:
Přihlášení
Uživatelské jméno: Heslo:
STRÁNKY ARCHIVOVÁNY NÁRODNÍ KNIHOVNOU ČR

Pravděpodobnost abiogeneze

Předmluva

Tento článek byl částečně přeložen a upraven (zkrácen) z archivu TalkOrigins.

Úvod

Hodně často se setkáváme ze strany kreacionistů s tvrzením, že pravděpodobnost toho, aby vznikl ten nejjednodušší enzym pouhou náhodou je mizivá, což znamená, že abiogeneze možná není. Jako doklad svých tvrzení uvádí obrovská čísla, aby dokázali, že abiogeneze je statisticky nemožná. Všichni se však dopouštějí několika chyb.

  1. Počítají pravděpodobnost vzniku "moderních" bílkovin nebo dokonce celých baktérií s "moderními" bílkovinami pouhou náhodou. Toto však není teorie abiogeneze.
  2. Také se domnívají, že existuje pevný počet bílkovin s pevnou sekvencí pro každou bílkovinu, potřebných pro život.
  3. Počítají pravděpodobnosti po sobě jdoucím postupem nikoliv paralelním.
  4. Nerozumí tomu co je pravděpodobnostním výpočtem míněno.
  5. Velmi podceňují počet funkčních enzymů obsažených v souboru náhodných výsledků směřujících k požadovanému enzymu.

Teď vás provedu jednotlivými chybami a ukážu vám, jak je nemožné počítat "pravděpodobnost abiogeneze".

Prvotní protoplazmatická globule

Pravděpodobnost vytvoření bílkoviny čítající 300 aminokyselin (řekněme enzym podobný karboxypeptidáze) náhodou je (1/20)300 nebo šance jedna ku 2,04x10390, což je absurdní a naprosto nepravděpodobné. Vše bude ještě umocněno pokud budeme chtít vytvořit řetězec dlouhý 400. Čísla budou tak obrovská a šance téměř nulová. Toto nám vnucuje myšlenku, že vznik i nejjednoduššího organizmu se zdá být naprosto nemožný. Nicméně je to všechno špatně.

Obr. 1 Hypotetická prabuňka ve srovnání s obyčejnou buňkou

Zaprvé, vznik biologických polymerů z monomerů je funkcí chemických a biochemickcýh zákonů a ty rozhodně náhodné nejsou.

Zadruhé, už původní myšlenka je nesprávná, neboť v moderní teorii abiogeneze by byla první "živá věc" mnohem jednodušší, možná jednodušší než protobakterie nebo preprotobakterie (kterou Oparin nazval protobiont 8 Woese jí říká progenot 4). Byla by to jednoduchá molekula pravděpodobně ne větší než 30-40 dílčích jednotek dlouhá. Tyto jednoduché molekuly se pak pomalu vyvíjely ve složitější kooperativní sebereplikující systémy. Pak se až konečně vyvinuly v jednoduché organismy 2,5,10,15,28. Pro porovnání je zde uveden obrázek hypotetického protobionta a moderní bakterie.

První "živá věc" mohla být první sebereplikující molekula, podobná samosereplikujícímu peptidu ze skupiny Ghadiri 7,17 nebo sebereplikujícímu hexanukleotidu 10 nebo možná RNA polymeráza, která funguje sama o sobě 12.

Další možností je, že prvními sebereplikátory byly skupiny katalyzátorů, také bílkovinové enzymy nebo RNA ribozymy, které se navzájem regenerují v katalytickém cyklu 3,5,15,26,28. Příkladem může být sebereplikátor SunY ze tří dílčích jednotek 24. Tyto katalytické cykly mohly být ohraničeny v rámci malé vodní nádrže nebo laguny. Nebo mohly být tyto katalytické komplexy adsorbovány také do jílů nebo tuků na jílech. To nám dává mnoho katalytických sekvencí ve skupině náhodných peptidů nebo polynukleotidů. Není tedy nepravděpodobné, že malý katalytický komplex mohl vzniknout.

Obr. 2 Sebereplikace v malém peptidu

Tyto dva modely nejsou navzájem vylučující. Ghadiri peptidy mohou mutovat a vytvářet katalytické cykly 9.

Není důležité zda první sebereplikující "organizmus" byla jednoduchá molekula nebo complex malých molekul. Tento model se nepodobá tornádu vytvářejícímu boeing 747. Ale shrňme si to. Zde je jednoduché srovnání teorie, která je kritizována kreacionisty a skutečné teorie abiogeneze.

Všimněte si, že skutečná teorie má spoustu malých kroků i přesto, že jsem pro zjednodušení některé vynechal (zvl᚝ mezi hypercyklem a probiontem). První moderní abiogeneze byla formulována Oparinem a Haldanem ve dvacátých letech dvacátého století a začala jednoduchým proteinem nebo proteinoidem zdokonalujícího se pomalu v buňku. Dokonce ani myšlenky obíhající v padesátých letech devatenáctého století nebyly "spontáními" teoriemi. Nejbližší je snad Lamarckova původní myšlenak z roku 1803! 8

Obr. 3 Nesprávný pohled na abiogenezi

Je tedy vidět, že kreacionisté v podstatě kritizují teorii starou přes 150 let, kterou už nepodporuje žádný současný evoluční biolog.

Mýtus o "živé sekvenci"

Dalším často slýchaným tvrzením je, že existuje nějaká "živá sekvence" čtyř set bílkovin, a že sekvence aminokyselin těchto proteinů nemůže být změněna, protože jinak by organizmus nepřežil.

To je samozřejmě nesmysl. Zdá se, že tvrzení "o 400 bílkovinách" vychází z genomu kodujícím bílkoviny Mycobacterium genetalium, která má nejmenší známý genom ze všech známých současných organismů 20. Nicméně, průzkum tohoto genomu ukázal, že může být redukován na sadu kódující 256 bílkovin 20. Všimněte si, že se opět jedná o "moderní" organismus. První protobiont/progenot by byl stále menší a předcházely by mu jednodušší chemické systémy 3,10,11,15.

Stejně tak tvrzení, že posloupnost bílkovin nemůže být změněna je také nesmysl. Ve většině bílkovin jsou oblasti, kde v podstatě každá aminokyselina může být nahrazena a jiné oblasti, kde mohou být provedeny konzervativní substituce (kde nabitá aminokyselina může být vyměněna za jinou nabitou aminokyselinu, neutralní za jinou neutrální aminokyselinu a hydrofobní aminokyselina za jinou hydrofobní).

"Živá sekvence" je mýtus...

Hod mincí pro začátečníky a makromolekulární skládání

Pojďme tedy hrát s kreacionisty jejich hru a podívejme se na vytvoření peptidu pouhou náhodou přidáváním aminokyselin. Sice to není způsob jakým vznikly peptidy na Zemi, ale bude to ilustrativní.

Použiji jako příklad sebereplikující peptid ze skupiny Ghadiri jmenované výše 7. Mohu použít jiný příklad, jako třeba sebereplikující hexanucleotide 10, SunY sebereplikátor 24 nebo RNA polymerázu popsanou Ecklandem 12, ale pro historickou návaznost s kreacionistickým tvrzením jsem zvolil peptid. Tento peptid se skládá ze 32 aminokyselin se sekvencí RMKQLEEKVYELLSKVACLEYEVARLKKVGE a je to enzym. Peptid ligáza, která vytváří sama sebe ze dvou šestnácti aminokyselinových podjednotek. Je to také velikost a kompozice, která může ideálně sedět pro vytvoření syntézou abiotických peptidů. Fakt, že se jedná o sebereplikátor je přidáno jen jako třešnička na dortu.

Pravděpodobnost vzniku náhodnými pokusy je (1/20)32 nebo šance jedna ku 4,29x1040. Je to mnohem mnohem pravděpodobnější než jedna ku 2,04x10390, kterou uvádí kreacionisté jako "vytvoření karboxypeptidáze pouhou náhodou", ale stále je to šance absrudně malá.

Nicméně je zde jiná strana pravděpodobnostních odhadů. Závisí na faktu, že většina z nás nemá cit pro statistiky. Když někdo řekne, že se něco stane s pravděpodností jedna ku milionu, mnoho z nás očekává, že musí projít všech milion pokusů, aby se ta určitá událost skutečně stala. Ovšem to je chyba.

Zde je jeden experiment. Vezměte minci (hlava-orel), hodtě ji čtyřikrát, zapiště si výsledky a udělejte to znovu. Kolikrát si myslíte, že budete muset opakuvat tuto proceduru, abyste hodili čtyři hlavy v řadě.

Pravděpodobnost že hodíte čtyři hlavy v řadě je (1/2)4 nebo 1 ku 16. Musíme skutečně hodit 16krát, abychom dostali čtyři hlavy v řadě (HHHH)? Ne. Výsledky, které jsem obdržel, byly 11, 10, 6, 16, 1, 5 a 3 pokusy než jsem hodil HHHH. Šance 1 ku 16 (nebo 1 ku milionu nebo 1 ku 1040) dává pravděpodobnost události v daném pokusu, neříká však kdy požadovaná situace nastane. Můžete hodit HHHH hned na první pokus (mě se to povedlo). Dokonce i šance 1 ku 4,29x1040, sebereplikátor se může objevit překvapivě rychle. Ale je toho ještě víc.

Šance 1 ku 4,29x1040 je stále mizivá a velmi nepravděpodobná. Je těžké nakládat s tak velkým číslem. Dokonce i s výše uvedeným arugmentem (můžete to získat hned na prvních pokus) většina lidí řekne "jistě, to by trvalo mnohem déle než existuje samotná Země, pokud by se měl vytvořit tento replikátor pouhou náhodou". Ne tak docela. V experimentech výše jsme házeli po sobě jdoucími pokusy. Je to jako by každý jeden protein/DNA/proto-replikátor byl vytvářen jednou za jeden cyklus. Ve skutečnosti by tu byly miliardy současných pokusů jako jsou miliardy molekul v oceánu nebo tisíce kilometrů pobřežních čar, které mohou být vhodné pro katalytické děje 2,15.

Vrame se k našemu experimentu s mincí. Řekněme, že trvá minutu než hodíme mince čtyřikrát. K hození HHHH by nám stačilo v průměru osm minut. Nyní si přiveďme 16 přátel, každého s mincí proto, aby všichni hodili čtyřikrát. Průměrný čas potřebný k vygenerování HHHH je teď jedna minuta. Teď se pokusme hodit 6 hlav v řadě. Pravděpodobnost je nyní (1/2)6 nebo šance 1 ku 64. Teď to potrvá průměrně půl hodiny. Běžte však ven a přiveďte 64 lidí a můžete toho docílit za minutu. Pokud chcete hodit sekvenci s šancí 1 ku miliardě, naverbujte obyvatele Číny, aby každý z nich hodil mincí. Dostanete požadovanou sekvenci hned po prvních dokončených hodech.

Takže pokud je v naší prebiotické Zemi miliarda peptidů rostoucích současně, značně to redukuje čas potřebný pro vytvoření hledaného replikátoru.

Dobrá, znovu se podíváme na naše číslo. Šance 1 ku 4,29x1040. To je velké číslo. Ačkoliv miliarda molekul je hodně molekul, můžeme obdržet dostatek molekul pro náhodné sestavení prvního replikátoru dříve než za půl miliardy let?

Ano. Jeden kilogram aminokyseliny arginine obsahuje 2,85x1024 molekul (to je dobře přes miliardu miliard). Tuna argininu obsahuje 2,85x1027 molekul. Když vezmete náklaďák každé aminokyseliny a vylejete ho do středně velkého jezírka, dostanete dostatek molekul pro vytvoření našeho konkrétního replikátoru během několika desítek let díky tomu, že bílkovinu o délce 55 aminokyselin získáte během jednoho nebo dvou týdnů 14,16.

Jak toto všechno zapadá do prebiotické Země? Oceán na Zemi mohl obsahovat asi 1x1024 litrů. S koncentrací 1x10-6 M (středně zředěná polévka, viz Chyba a Sagan 1992 [23]) je tu zhruba 1x1050 potenciálních šancí, aby vznikl peptid ligáza (asi 1x1031), což by trvalo něco pod jeden rok, natož pak za milion let. Syntéza primitivního sebereplikátoru by mohla nastat relativně rychle i s pravděpodobností 1 ku 4,29x1040 (a pamatujte na to, že požadovaný replikátor může vzniknout hned v prvním pokusu).

Předpokládejme, že vytvoření sekvence trvá týden 14,16. Potom Ghadiri ligáza může být vygenerována za týden a jákakoliv sekvence cytochromu C může být vygenerována za něco málo přes jeden milion let.

Ačkoliv jsem použil jako příklad Ghadiri ligázu, jak jsem se zmínil dříve, lze tento proces také použít pro SunY samoreplikátor nebo pro Ekland RNA polymerázu.

Hledání jehly v kupce sena

Takže jsme si ukázali, že generování určitého malého enzymu není tak deprimující, jak se snaží ukázat kreacionisté. Další nedorozumění pramení z pocitu spousty lidí, že počet enzymů/ribozymů reprezentuje velmi nepravděpodobnou konfiguraci, a že pravděpodobnost vygenerování jednoho enzymu/ribozymu je postupným přidáváním aminokyselin příliš malá.

Nicméně výzkum provedený Eklandem předpokládá, že v RNA o délce 220 nukleotidů je ohromné množství 2,5x10112 sekvencí patřících efektivním ligázám 12. Vrátíme-li se zpátky k našemu primitivnímu oceánu o objemu 1x1024 litrů a předpokladu, že koncentrace nukleotidů je 1x10-7 M [23], pak tu máme zhruba 1x1049 potenciálních nukleotidových řetězců. Takže solidní počet efektivních RNA ligáz (asi 1x1034) může být vyprodukován během roku, natož potom za milion let. Potencionální počet RNA polymeráz je také velký. Asi 1 v 1020 sekvenci je RNA polymeráza 12. Podobnou úvahu můžeme použít i pro další RNA řetězce.

Takže, s realističtějšími počty, náhodné sestavení aminokyselin v "život podporující" systémy se zdá být naprosto reálné, dokonce i s pesimistickými čísly pro koncentrace monomerů 23 a čas syntézy.

Závěr

Kreacionistické výpočty pravděpodobností v této otázce jsou nesprávné. Navíc je tento argument provázen spoustou biologických a statistických lží.

V tuto chvíli, protože nemáme ponětí jak pravděpodobný je vznik života, je prakticky nemožné určit jakoukoliv smysluplnou pravděpodobnost k jakémukoliv kroku mezi neživým a živým kromě dvou prvních kroků (vznik polymeru z monomeru, p=1.0; vznik katalytických polymerů, p=1,0).

Vznik života je nicméně závislý na chemii a biochemii, nikoliv na házení mincí.

Literatura:
[1] Unrau PJ, and Bartel DP, RNA-catalysed nucleotide synthesis. Nature, 395: 260-3, 1998
[2] Orgel LE, Polymerization on the rocks: theoretical introduction. Orig Life Evol Biosph, 28: 227-34, 1998
[3] Otsuka J and Nozawa Y. Self-reproducing system can behave as Maxwell′s demon: theoretical illustration under prebiotic conditions. J Theor Biol, 194, 205-221, 1998
[4] Woese C, The universal ancestor. Proc Natl Acad Sci USA, 95: 6854-6859.
[5] Varetto L, Studying artificial life with a molecular automaton. J Theor Biol, 193: 257-85, 1998
[6] Wiegand TW, Janssen RC, and Eaton BE, Selection of RNA amide synthases. Chem Biol, 4: 675-83, 1997
[7] Severin K, Lee DH, Kennan AJ, and Ghadiri MR, A synthetic peptide ligase. Nature, 389: 706-9, 1997
[8] Ruse M, The origin of life, philosophical perspectives. J Theor Biol, 187: 473-482, 1997
[9] Lee DH, Severin K, Yokobayashi Y, and Ghadiri MR, Emergence of symbiosis in peptide self-replication through a hypercyclic network. Nature, 390: 591-4, 1997
[10] Lee DH, Severin K, and Ghadri MR. Autocatalytic networks: the transition from molecular self-replication to molecular ecosystems. Curr Opinion Chem Biol, 1, 491-496, 1997
[11] Di Giulio M, On the RNA world: evidence in favor of an early ribonucleopeptide world. J Mol Evol, 45: 571-8, 1997
[12] Ekland EH, and Bartel DP, RNA-catalysed RNA polymerization using nucleoside triphosphates. Nature, 383: 192, 1996
[13] Lohse PA, and Szostak JW, Ribozyme-catalysed amino-acid transfer reactions. Nature, 381: 442-4, 1996
[14] Ferris JP, Hill AR Jr, Liu R, and Orgel LE, Synthesis of long prebiotic oligomers on mineral surfaces [see comments]. Nature, 381: 59-61, 1996
[15] Lazcano A, and Miller SL, The origin and early evolution of life: prebiotic chemistry, the pre- RNA world, and time. Cell, 85: 793-8, 1996
[16] Ertem G, and Ferris JP, Synthesis of RNA oligomers on heterogeneous templates. Nature, 379: 238-40, 1996
[17] Lee DH, Granja JR, Martinez JA, Severin K, and Ghadri MR, A self-replicating peptide. Nature, 382: 525-8, 1996
[18] Joyce GF, Building the RNA world. Ribozymes. Curr Biol, 6: 965-7, 1996
[19] Ishizaka M, Ohshima Y, and Tani T, Isolation of active ribozymes from an RNA pool of random sequences using an anchored substrate RNA. Biochem Biophys Res Commun, 214: 403-9, 1995
[20] Mushegian AR and Koonin, EV, A minimal gene set for cellular life derived by comparison of complete bacterial genomes. Proc. Natl. Acad. Sci. USA, 93: 10268-10273.
[21] Ekland EH, Szostak JW, and Bartel DP, Structurally complex and highly active RNA ligases derived from random RNA sequences. Science, 269: 364-70, 1995
[22] Breaker RR, and Joyce GF, Emergence of a replicating species from an in vitro RNA evolution reaction.Proc Natl Acad Sci U S A, 91: 6093-7, 1994
[23] Chyba C and Sagan C, Endogenous production, exogenous delivery and impact-shock synthesis of organic molecules: an inventory for the origins of life. Nature, 355: 125-32., 1992
[24] Doudna JA, Couture S, and Szostak JW, A multisubunit ribozyme that is a catalyst of and template for complementary strand RNA synthesis. Science, 251: 1605-8, 1991
[25] Lahav N, Prebiotic co-evolution of self-replication and translation or RNA world? J Theor Biol, 151: 531-9, 1991
[26] Stadler PF, Dynamics of autocatalytic reaction networks. IV: Inhomogeneous replicator networks. Biosystems, 26: 1-19, 1991
[27] Eigen M, Gardiner W, Schuster P, and Winkler-Oswatitsch R, The origin of genetic information. Sci Am, 244: 88-92, 96, et passim, 1981
[28] Eigen M, and Schuster P, The hypercycle. A principle of natural self-organization. Springer-Verlag, isbn 3-540-09293, 1979
[29] Yockey HP, On the information content of cytochrome c. J Theor Biol, 67: 345-76, 1977
 
[Přidat komentář] [Všechna vlákna] [Zobrazit všechny] [Skrýt komentáře] [Zobrazit vybrané] [Za sebou] Komentáře ke článku
  • 16.03.2016 16:35 (Vložil: Hugo Rob)
  • 02.11.2015 11:36 (Vložil: Fotón)
  • 02.01.2010 12:11 (Vložil: howto)
    • 02.01.2010 20:08 (Vložil: Daniel Madzia)
      • 05.01.2010 17:13 (Vložil: howto)
    • 02.01.2010 12:12 (Vložil: howto)
  • 23.11.2009 17:06 (Vložil: howto)
    • 12.12.2009 21:00 (Vložil: Grush)
      • 13.12.2009 10:23 (Vložil: Mephisto)
        • 27.12.2009 11:47 (Vložil: howto)
          • 27.12.2009 23:42 (Vložil: Mephisto)
            • 28.12.2009 13:36 (Vložil: Mephisto)
            • 27.12.2009 23:51 (Vložil: Mephisto)
              • 29.12.2009 11:05 (Vložil: Millerův pokus ??? Ostuda !!!)
                • 29.12.2009 14:26 (Vložil: Mephisto )
                • 29.12.2009 14:06 (Vložil: Mephisto )
  • 23.11.2009 17:00 (Vložil: howto)
    • 23.11.2009 17:53 (Vložil: censored)
      • 26.11.2009 08:13 (Vložil: howto)
        • 26.11.2009 18:06 (Vložil: censored)
      • 23.11.2009 19:24 (Vložil: Queen)
  • 23.11.2009 11:13 (Vložil: howto)
    • 12.12.2009 13:09 (Vložil: Grush)
      • 12.12.2009 19:57 (Vložil: Mephisto )
        • 12.12.2009 20:44 (Vložil: Grush)
          • 12.12.2009 23:03 (Vložil: Mephisto)
            • 16.12.2009 11:23 (Vložil: Grush)
              • 16.12.2009 17:38 (Vložil: Mephisto )
                • 16.12.2009 20:24 (Vložil: Mephisto )
                  • 28.12.2009 17:23 (Vložil: Grush)
              • 16.12.2009 15:44 (Vložil: Grush)
  • 29.06.2009 13:56 (Vložil: Fotón)
    • 30.06.2009 09:08 (Vložil: Fotón)
      • 30.06.2009 11:41 (Vložil: Fotón)
  • 18.06.2009 23:58 (Vložil: Telesto)
    • 29.06.2009 13:43 (Vložil: Fotón)
  • 15.05.2009 18:47 (Vložil: Fotón)
  • 20.03.2009 22:00 (Vložil: Filip Jetmar)